DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6972 and AT1G47740

DIOPT Version :10

Sequence 1:NP_001303445.1 Gene:CG6972 / 42684 FlyBaseID:FBgn0039008 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_564513.1 Gene:AT1G47740 / 841185 AraportID:AT1G47740 Length:279 Species:Arabidopsis thaliana


Alignment Length:57 Identity:10/57 - (17%)
Similarity:25/57 - (43%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 KQTPEEQQAWAMFMCNLFENLGPSEWLLYISEWEYNGQTISNIRVTTK-VAVHCILS 194
            |:.|::::.|:..:.......|....::....|    :::..:.:.:| ||..|..|
plant     5 KEEPKQKKGWSESLLEFRSGFGEKMKVVSKKRW----KSLGPLHLKSKSVARFCFFS 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6972NP_001303445.1 None
AT1G47740NP_564513.1 Peptidase_C97 69..206 CDD:461775
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.