DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d4 and ERG11

DIOPT Version :9

Sequence 1:NP_651082.1 Gene:Cyp6d4 / 42682 FlyBaseID:FBgn0039006 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_011871.1 Gene:ERG11 / 856398 SGDID:S000001049 Length:530 Species:Saccharomyces cerevisiae


Alignment Length:382 Identity:87/382 - (22%)
Similarity:161/382 - (42%) Gaps:87/382 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 HMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQK----ELPEEGFK--------EV-----DIKKVM 177
            |:.:|.|..|.:       .|..:..:...:|    .|.:|.||        ||     |.|...
Yeast   128 HLTTPVFGKGVI-------YDCPNSRLMEQKKFVKGALTKEAFKSYVPLIAEEVYKYFRDSKNFR 185

  Fly   178 QNY----AIDIIAS----TIF-------GLDVNSFENPDNKFRKLVSLARANNRFNAMFGMMIFL 227
            .|.    .||::.:    |||       |.::.:  ..|..|..|.|      ..:..|..:.|:
Yeast   186 LNERTTGTIDVMVTQPEMTIFTASRSLLGKEMRA--KLDTDFAYLYS------DLDKGFTPINFV 242

  Fly   228 VPS--IAQFLFRIGFKNPVGLAMLQIVKETVEYREKHGIVRKDLLQLLIQLRNTGKIDENDEKSF 290
            .|:  :..:..|...:..:....:.::||.   |:.:.|..:||:..|:         :|.....
Yeast   243 FPNLPLEHYRKRDHAQKAISGTYMSLIKER---RKNNDIQDRDLIDSLM---------KNSTYKD 295

  Fly   291 SIQKTPDGHIKTISLEAITAQAFIFYIAGQETTGSTAAFTIYELAQYPELLKRLQDEVDETLAKN 355
            .::.| |..|..:.:..:        :.||.|:.:|:|:.:..||:.|::.:.|.:|....|...
Yeast   296 GVKMT-DQEIANLLIGVL--------MGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDGG 351

  Fly   356 DGKITYDSLNKMEFLDLCVQETIRKYPGLPILNRECTQDYTVPDTNHVIPKGTPVVISLYGIHHD 420
            ..::|||.|.:|..|:..::||:|.:..|..|.|:..:|..||:|::|||.|..|::|....|..
Yeast   352 KKELTYDLLQEMPLLNQTIKETLRMHHPLHSLFRKVMKDMHVPNTSYVIPAGYHVLVSPGYTHLR 416

  Fly   421 AEYFPDPETYDPERFSEES-RNYN----------------PTAFMPFGEGPRICIAQ 460
            .||||:...::..|::::| .:|:                .:.::|||.|...||.:
Yeast   417 DEYFPNAHQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGE 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d4NP_651082.1 p450 58..500 CDD:278495 87/382 (23%)
ERG11NP_011871.1 CYP51-like 83..521 CDD:410668 87/382 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I1492
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1477
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.