DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d4 and CYP72C1

DIOPT Version :9

Sequence 1:NP_651082.1 Gene:Cyp6d4 / 42682 FlyBaseID:FBgn0039006 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:277 Identity:50/277 - (18%)
Similarity:98/277 - (35%) Gaps:70/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FSLILLAVTLLTLAWFYL--KRHYEYWERRGFPFEKHSGIPFGCLDSVWRQEKSMGLA------- 57
            |.:::|......:.|.:|  ||..:|.:::||     ||..:..|....|:...|...       
plant    15 FLILILNWVWRAVNWVWLRPKRLEKYLKKQGF-----SGNSYRILMGDMRESNQMDQVAHSLPLP 74

  Fly    58 ------------IYDVYVKSKERVLGIYLLFRPAVLIRDADLARRVLAQDFASFHDRGVY----V 106
                        ::...:|..::....|..: |.|::.|.:..|.::::     |:  ::    :
plant    75 LDADFLPRMMPFLHHTVLKHGKKCFTWYGPY-PNVIVMDPETLREIMSK-----HE--LFPKPKI 131

  Fly   107 DEERDPLSANIFSLRGQSWRSMRHMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQKELPEEGFKEV 171
            ........:.:.:..|..|...|.:|:|.|....|||:.........:|:...::....:|..|:
plant   132 GSHNHVFLSGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEEWERLASAKGTMEL 196

  Fly   172 DIKKVMQNYAIDIIASTIFG---------------------LDVNSFENPDNKF------RKLVS 209
            |......:...:::|...||                     |.:.:...|.:||      |:|  
plant   197 DSWTHCHDLTRNMLARASFGDSYKDGIKIFEIQQEQIDLGLLAIRAVYIPGSKFLPTKFNRRL-- 259

  Fly   210 LARANNR-FNAMFGMMI 225
              |...| ..|||..||
plant   260 --RETERDMRAMFKAMI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d4NP_651082.1 p450 58..500 CDD:278495 36/200 (18%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.