DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d4 and CYP705A32

DIOPT Version :9

Sequence 1:NP_651082.1 Gene:Cyp6d4 / 42682 FlyBaseID:FBgn0039006 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_188731.1 Gene:CYP705A32 / 821645 AraportID:AT3G20950 Length:526 Species:Arabidopsis thaliana


Alignment Length:469 Identity:105/469 - (22%)
Similarity:195/469 - (41%) Gaps:82/469 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QEKSMGLAIYDVYVKSKERV-------LGIYLLFRPAVLIRDADLARRVLAQDFASFHDRGVYVD 107
            |..::.|.:..:..||.:::       |.:.:...|.||...|.:|..:......:...|| :..
plant    55 QSNNLHLLLSALVHKSFQKISYKYGPLLHLRVFHVPIVLASSASVAYEIFKAQDVNVSSRG-HAP 118

  Fly   108 EERDPL---SANIFSLRGQSWRSMRHMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQKELPEE--G 167
            .....|   |:..|:..|..::.||.:::.     ||         :|.:.:...:|...:|  .
plant   119 AGESLLFGSSSFFFAPYGDYFKFMRKLIAT-----KL---------LGPQALERSRKIRADELDR 169

  Fly   168 FKEVDIKKVMQNYAIDIIASTIFGLDVNSFENPDNKFRKLV---SLARANNRFNAMFGMMIFLVP 229
            |....:.|.|:..::||:..   ...:|     :|...|::   |.:..|.....:.|::|....
plant   170 FYRNLLDKAMKKESVDIVEE---AAKLN-----NNIICKMIMGRSCSEDNGEAERVRGLVIESTA 226

  Fly   230 SIAQFLFRIGFKNP---VGLAMLQ------------IVKETVEYREKHGIVRK--DLLQLLIQLR 277
            ...|....:.|..|   :|:::.|            :.|..||:.|:.|...|  |::.||::..
plant   227 LTKQIFLGMIFDKPLKKLGISLFQKDIKSVSRFDELLEKILVEHEERMGKHYKANDMMDLLLEAY 291

  Fly   278 NTGKIDENDEKSFSIQKTPDGHIKTISLEAITAQAFIFYIAGQETTGSTAAFTIYELAQYPELLK 342
            .    |||.|     .|....|||::.::.:        |||.:|:..|..:|:.||...|.:|:
plant   292 G----DENAE-----YKITRNHIKSLFVDLV--------IAGTDTSAQTIEWTMAELINNPNILE 339

  Fly   343 RLQDEVDETLAKNDGKITYDSLNKMEFLDLCVQETIRKYPGLPILNRECTQDYTVPDTNHVIPKG 407
            ||::|: |::..|...:....|..:.:|...|:|.:|.:|...:..|...:...:  ....||:.
plant   340 RLREEI-ESVVGNTRLVQETDLPNLPYLQAVVKEGLRLHPPGAVFLRTFQERCEL--KGFYIPEK 401

  Fly   408 TPVVISLYGIHHDAEYFPDPETYDPERFSEESRN-------YNPTAFMPFGEGPRICIAQRMGRI 465
            |.:|:::|.|..|.:.:.|||.:.||||...||:       .....:|||..|.|.|....:..:
plant   402 TLLVVNVYAIMRDPKLWEDPEEFKPERFIASSRSGQEDEIREEVLKYMPFSTGRRGCPGSNLAYV 466

  Fly   466 NSKLAIIKILQNFN 479
            :...||..:.|.|:
plant   467 SVGTAIGVMAQCFD 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d4NP_651082.1 p450 58..500 CDD:278495 103/461 (22%)
CYP705A32NP_188731.1 p450 16..514 CDD:299894 105/469 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.