DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d4 and CYP705A23

DIOPT Version :9

Sequence 1:NP_651082.1 Gene:Cyp6d4 / 42682 FlyBaseID:FBgn0039006 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_188649.1 Gene:CYP705A23 / 821557 AraportID:AT3G20140 Length:510 Species:Arabidopsis thaliana


Alignment Length:464 Identity:93/464 - (20%)
Similarity:192/464 - (41%) Gaps:74/464 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IYL-LFR-PAVLIRDADLARRVLAQDFASFHDRGVYVDEERDPLSANIF--------SLRGQSWR 126
            :|| :|. |.:.:..|.:|..:......:...||      ..|:..::.        :..|..|:
plant    78 LYLRIFNVPIIFVSSASVAYEIFRGHDVNISFRG------NPPIEESLLVGSFGFFTAPYGDYWK 136

  Fly   127 SMRH-MLSPCFTSGKLKSMFSTSEDIGDKMVAH-LQKELPEEGFKEVDIKKVMQNYAIDIIASTI 189
            .|:. |::.......|:.......|..::...: |.|.:.:|   .|:|.|.......|.|...|
plant   137 FMKKVMVTKLLGPQALQRSRGIRADALERFYMNLLDKAMKKE---SVEIGKETMKLIYDSICKMI 198

  Fly   190 FGLDVNSFENPDNKFRKLVSLARANNRFNAMFGMMIFLVPSIAQFLFRIG---FKNPVGLAMLQI 251
            .|.:.:.......:.|.||:.:.|..:       .||:...:.:.|.::|   ||..:    :.:
plant   199 MGRNFSEENGEAERVRGLVTESTALTK-------KIFMANVLHKPLKKLGISLFKKEI----MDV 252

  Fly   252 VKETVEYREKHGIVRKDLLQ----------LLIQLRNTGKIDENDEKSFSIQKTPDGHIKTISLE 306
            .....|..|:..:..::.|.          ||...|     |:|.|     .|....|||::.::
plant   253 SNSFDELLERFLVEHEEKLNEDQDMDMMGVLLAACR-----DKNAE-----CKITRNHIKSLFVD 307

  Fly   307 AITAQAFIFYIAGQETTGSTAAFTIYELAQYPELLKRLQDEVDETLAKNDGKITYDS-LNKMEFL 370
            .:        :||.:|:.....:|:.|:...|::|:::::|:...:.:.  ::..:: |..:.:|
plant   308 LV--------VAGTDTSRHATQWTMAEIINKPKVLEKVREEIYSVVGRT--RLVQETDLPSLPYL 362

  Fly   371 DLCVQETIRKYPGLPILNRECTQDYTVPDTNHVIPKGTPVVISLYGIHHDAEYFPDPETYDPERF 435
            ...|:|.:|.:|..|:..|...:.::|  ....:|:.||:|::.|.:..|...:.||..:.||||
plant   363 QATVKEGLRLHPPGPLFARTAREGFSV--GGFYVPENTPLVVNAYAMMRDPGSWEDPNEFKPERF 425

  Fly   436 ----SEESRNYNPTAFMPFGEGPRICIAQRMGRINSKLAIIKILQNFNVEVM-SRSEIEFENSGI 495
                .|:.|.:. ..::|||.|.|.|....:..|....||..::|.|:.::. ::..:|.....:
plant   426 LGSGKEDEREHG-LKYIPFGSGRRGCPGINLAYILVGTAIGVMVQCFDWKIKGNKVNMEEARGSL 489

  Fly   496 ALIPKHGVR 504
            .|...|.::
plant   490 VLTMAHPLK 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d4NP_651082.1 p450 58..500 CDD:278495 92/458 (20%)
CYP705A23NP_188649.1 p450 26..504 CDD:386267 93/464 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.