DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d4 and Cyp3a73

DIOPT Version :9

Sequence 1:NP_651082.1 Gene:Cyp6d4 / 42682 FlyBaseID:FBgn0039006 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_038945885.1 Gene:Cyp3a73 / 498198 RGDID:1595705 Length:504 Species:Rattus norvegicus


Alignment Length:519 Identity:167/519 - (32%)
Similarity:278/519 - (53%) Gaps:82/519 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ILLAVTLLTLAWFYLKRHYEYWERRGFPFEKHSGIPF-GCLDSVWRQEKSMGLAIYDVYVKSK-E 67
            :|||: :|.|.:.:..|.:..::::|.|..|  .:|| |.:.:.:|     ||..:|:....| .
  Rat    13 LLLAI-ILVLFYRFGTRTHGIFKKQGIPGPK--PLPFLGTVLNYYR-----GLWKFDMECYKKCG 69

  Fly    68 RVLGIYLLFRPAVLIRDADLARRVLAQD-FASFHDR------GVYVDEERDPLSANIFSLRGQSW 125
            ::.|::....|...|.|.::.:.||.:: |:.|.:|      |:        :|.:|...:.:.|
  Rat    70 KIWGLFDGQTPVFAIMDTEMIKSVLVKECFSVFTNRRNIGPVGI--------MSKSISVAKDEEW 126

  Fly   126 RSMRHMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQKELPEEGFKEVDIKKVMQNYAIDIIASTIF 190
            :..|..|||.||||:||.||...|..||.:|.:|:::: |:| |.:.:|:|...|::|:|.||.|
  Rat   127 KRYRAFLSPTFTSGRLKEMFPIIEHYGDILVKYLKQKV-EKG-KPLAMKEVFGAYSMDVITSTSF 189

  Fly   191 GLDVNSFENPDNKFRKLVSLARANNRFNAMFGMMI---FLVP-------------SIA---QFLF 236
            .:::||..||.:.|.:.|...:..:.|:.:|..::   ||.|             |:|   :|::
  Rat   190 EVNINSINNPKDPFVEKVKKFQRFDFFDPLFLSVVLFPFLTPIYEMLNICLFPKDSVAFFQKFVY 254

  Fly   237 RIGFKNPVGLAMLQIVKET-VEYREKHGIVRKDLLQLLIQLRNTGKIDENDEKSFSIQKTPDGHI 300
            |              :|:| ::.:.||   |.|.|||::...|..| |:...|:.|         
  Rat   255 R--------------MKQTRLDSKHKH---RVDFLQLMMNAHNNSK-DKVSHKALS--------- 292

  Fly   301 KTISLEAITAQAFIFYIAGQETTGSTAAFTIYELAQYPELLKRLQDEVDETLAKNDGKITYDSLN 365
               .:| |.|||.||..|..|||.||.:|.:|.||.:|:..|:||:|:|..| .|....|||::.
  Rat   293 ---DIE-IVAQAIIFIFASYETTSSTLSFVLYSLATHPDSQKKLQEEIDRAL-PNKAPPTYDTVM 352

  Fly   366 KMEFLDLCVQETIRKYPGLPILNRECTQDYTVPDTNHVIPKGTPVVISLYGIHHDAEYFPDPETY 430
            :||:||:.:.||.|.||....|.|.|.:|..:...  .||||:.|:|..|.:.||.:::|:||.:
  Rat   353 EMEYLDMVLNETPRLYPIGYRLERVCKKDIKLDGV--FIPKGSVVMIPFYTLQHDPQHWPEPEEF 415

  Fly   431 DPERFSEESR-NYNPTAFMPFGEGPRICIAQRMGRINSKLAIIKILQNFNVEVMSRSEIEFENS 493
            .|||||:|:: :.:|..::|||.|||.||..|...:|.|||:.|:||||:.::...::|..:.|
  Rat   416 LPERFSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQLCEETQIPLKLS 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d4NP_651082.1 p450 58..500 CDD:278495 152/465 (33%)
Cyp3a73XP_038945885.1 CYP3A 67..493 CDD:410743 151/457 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.