DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d4 and AT3G32047

DIOPT Version :9

Sequence 1:NP_651082.1 Gene:Cyp6d4 / 42682 FlyBaseID:FBgn0039006 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001030796.1 Gene:AT3G32047 / 3769237 AraportID:AT3G32047 Length:502 Species:Arabidopsis thaliana


Alignment Length:463 Identity:112/463 - (24%)
Similarity:187/463 - (40%) Gaps:83/463 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GIYLLFR----PAVLIRDADLARRVLAQDFASFHDRGVYVDEERDP---------LSANIFSLRG 122
            |..||.|    |.||...|::|..:       |....|.:.....|         .|:.:.:..|
plant    75 GPLLLLRFFNVPVVLKSSANVAYEI-------FKTHDVNISSHGHPPIDECLFFGSSSFVVAPYG 132

  Fly   123 QSWRSMRH-MLSPCFTSGKLKSMFSTSEDIGDKMVAH-LQKELPEEGFKEVDIKKVMQNYAIDII 185
            ..||.|:. |::..|....|:.:....||..::...: |.||:..|   .|.|.|.......:.:
plant   133 YYWRLMKKLMVTKLFGPQALERLRHVREDELERFHTNLLSKEMKGE---TVQIAKEAIKLTNNSV 194

  Fly   186 ASTIFGLDVNSFENPDNKFRKLVSLARANNRFNAMFGMM--IFLVPSIAQFLFRIGFKNPVGLAM 248
            ...|.|..... ||.|        .||........|.::  |||. .:.:.||.|     :|:::
plant   195 CKMIMGRSCLE-ENGD--------AARVRGLVTETFALVKKIFLT-QVLRRLFEI-----LGISL 244

  Fly   249 LQ-------------IVKETVEYREKHGIVRKDLLQLLIQLRNTGKIDENDEKSFSIQKTPDGHI 300
            .:             :.|..||:.||......|::.:|:....    |||.|     .|....||
plant   245 FKKEILGVSRKFDEFLEKILVEHDEKPDFQGGDMMDVLLAAYR----DENAE-----YKITRNHI 300

  Fly   301 KTISLEAITAQAFIFYIAGQETTGSTAAFTIYELAQYPELLKRLQDEVDETLAKNDGKITYDSLN 365
            |::..|.|        :.|.:|:..|..:|:.|:...|.:|::|:.|:|..:.|. ..|....|.
plant   301 KSLFAELI--------LGGTDTSAQTIEWTMAEIINKPNILEKLRKELDSVVGKT-RLIEEKDLP 356

  Fly   366 KMEFLDLCVQETIRKYPGLPILNRECTQDYTVPDTNHVIPKGTPVVISLYGIHHDAEYFPDPETY 430
            .:.:|...|:|.:|.:|..|:..|:..:..|:  ..:.:||.|.:|::.|.:..|..|:.||:.:
plant   357 NLPYLQSVVKEGLRLHPPAPVFGRKVLEGCTI--KGYYVPKNTALVVNAYAVMRDPHYWEDPDEF 419

  Fly   431 DPERF------SEESRNYNPTAFMPFGEGPRICIAQRMGRINSKLAIIKILQNFNVEVMSRSEIE 489
            .||||      .||.|. ....::|||.|.|.|....:|.|....||..::..|:..|.. .::.
plant   420 KPERFLTTSSKKEEERE-QELKYIPFGSGRRGCPGVNLGYIFVGTAIGMMVHCFDWRVKG-DKVN 482

  Fly   490 FENSGIAL 497
            .:.:..||
plant   483 MDETAAAL 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d4NP_651082.1 p450 58..500 CDD:278495 112/463 (24%)
AT3G32047NP_001030796.1 p450 59..496 CDD:299894 112/463 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.