DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d4 and CYP705A28

DIOPT Version :9

Sequence 1:NP_651082.1 Gene:Cyp6d4 / 42682 FlyBaseID:FBgn0039006 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001154631.1 Gene:CYP705A28 / 3768880 AraportID:AT3G20935 Length:348 Species:Arabidopsis thaliana


Alignment Length:346 Identity:79/346 - (22%)
Similarity:137/346 - (39%) Gaps:86/346 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 SLARANNRFNAMFGMMI---FLVPSIAQFLFRIGFKNP---VGLAMLQ-------------IVKE 254
            |.:..|.....:.|::|   .|.|.|  ||..| |..|   :|:::.|             :.|.
plant     6 SCSEKNGEAERVRGLVIESLALSPKI--FLGMI-FHKPLKKLGISLFQKDIKSVSPKFDELLEKF 67

  Fly   255 TVEYREK----HGIVRKDLLQLLIQ---------------LRNT-----------GKIDENDEKS 289
            .||:.||    | ....|::.||::               :.||           ||...|   |
plant    68 LVEHEEKMEEDH-YKANDMMDLLLEAMEMRMQNVNLCIKRVSNTKARKPPILFRYGKYSNN---S 128

  Fly   290 FSIQKTPDGHIKTISLEAITAQAFIFYIAGQETTGSTAAFTIYELAQYPELLKRLQDEVDETLAK 354
            ..:|:                    ..:||.:|:.....:|:.||...|.:|:||::|: |::..
plant   129 LLLQE--------------------LLVAGTDTSALATQWTMAELINNPTILERLREEI-ESVVG 172

  Fly   355 NDGKITYDSLNKMEFLDLCVQETIRKYPGLPILNRECTQDYTVPDTNHVIPKGTPVVISLYGIHH 419
            |...|....|:.:.:|...|:|.:|.:|...|..|...:...:  ....||:.|.:|::.|.|..
plant   173 NTRLIQETDLSNLPYLQSVVKEGLRLHPPASISVRMSQERCEL--GGFYIPEKTLLVVNTYAIMR 235

  Fly   420 DAEYFPDPETYDPERFSEESRNYNP-------TAFMPFGEGPRICIAQRMGRINSKLAIIKILQN 477
            |..::.|||.:.||||...||:...       ..::||..|.|.|....:..::..:||..::|.
plant   236 DPNFWEDPEEFKPERFITSSRSEQEDEMREEVLKYIPFSAGRRGCPGSNLAYVSLGIAIGVMVQC 300

  Fly   478 FNVEVMSRSEIEFENSGIALI 498
            |:..:........|.:|..::
plant   301 FDWRIKGEKVNMSETAGTIML 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d4NP_651082.1 p450 58..500 CDD:278495 79/346 (23%)
CYP705A28NP_001154631.1 p450 <13..346 CDD:299894 77/339 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.