DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d4 and cyp-25A6

DIOPT Version :9

Sequence 1:NP_651082.1 Gene:Cyp6d4 / 42682 FlyBaseID:FBgn0039006 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001360017.1 Gene:cyp-25A6 / 187059 WormBaseID:WBGene00019438 Length:235 Species:Caenorhabditis elegans


Alignment Length:239 Identity:55/239 - (23%)
Similarity:103/239 - (43%) Gaps:31/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSLIL--LAVTLLTLAWFYLKRHYEYWERRGFPFEKHSGIP-------FGCLDSVWRQEKSMGL 56
            |..|||  :.|:|::...:.:....|.:..||     ..|:.       .|.|..:..::..:|.
 Worm     1 MAFLILTSILVSLVSFIIYVILARKERFRLRG-----KIGLSGPEPHWLMGNLKQIIERKAKLGY 60

  Fly    57 -AIYDVYVKSKER---VLGIYLLFRPAVLIRDADLARRVLAQDFASFHDR---GVYVDEE-RDPL 113
             ..||.|.|..::   ..|||...:..:.|.:.:..:.|..::|::|.||   .:..|.: ::.|
 Worm    61 DDSYDWYNKLHKQFGETFGIYFGTQLNINITNEEDIKEVFIKNFSNFSDRTPPPIIEDNKLKESL 125

  Fly   114 SANIFSLRGQSWRSMRHMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQKELPEEGFKEVDIKKVMQ 178
            ..|.:.   ..|:..|..::|.|::||:|:|..|.....| :...:.||....| ::.||....|
 Worm   126 LQNTYE---SGWKHTRSAIAPIFSTGKMKAMHETIHSKVD-LFLEILKEKASSG-QKWDIYDDFQ 185

  Fly   179 NYAIDIIASTIFGLDVNSFENPDNKF----RKLVSLARANNRFN 218
            ...:|:|....|.:|.|...:.::.|    ||.::.....:|.|
 Worm   186 GLTLDVIGKCAFAIDSNCQRDRNDIFYVNARKFITNIDIRHRQN 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d4NP_651082.1 p450 58..500 CDD:278495 42/172 (24%)
cyp-25A6NP_001360017.1 p450 37..>215 CDD:386267 41/182 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm4722
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.