DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6d4 and cest-32

DIOPT Version :9

Sequence 1:NP_651082.1 Gene:Cyp6d4 / 42682 FlyBaseID:FBgn0039006 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_504397.1 Gene:cest-32 / 178909 WormBaseID:WBGene00016862 Length:545 Species:Caenorhabditis elegans


Alignment Length:369 Identity:69/369 - (18%)
Similarity:113/369 - (30%) Gaps:130/369 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GLAIYDVYVKSKERVLGIYLLFRPAVLIRDADLARRVLAQDFASFHDRGVYVDEERDPLSANIFS 119
            |.|..:..:::||               ::|::.|     :||..|.   |..|:.:.|      
 Worm   236 GSAFCEFSIRTKE---------------QEAEIFR-----NFAKHHG---YEGEDSESL------ 271

  Fly   120 LRGQSWRSMRHM--LSPCFTSGKLKSMFST-----SEDIGDKMVAHLQKELPE----------EG 167
               ..|...:.:  .....|..|..|.|.|     ..|...|....|.:|.|:          ||
 Worm   272 ---LEWYKSQPLSKFQETATFEKKASGFLTFIPNFDGDFFPKPFDELSREAPKLDAMATVDEYEG 333

  Fly   168 FKEVDIKKVMQNYAIDIIASTIFGLDVNSFENPDNKFRKLVSLARANNRFNAMFGMMIFLVPSIA 232
            ...:.:.:..:| .:|||.|: ||.||  .||..:..::::.....|...|....:...|:..|:
 Worm   334 LGFLTMFQSRRN-DMDIIKSS-FGSDV--VENAVDVQKRIMEFYMKNIDKNDDKAVEKRLIQLIS 394

  Fly   233 QFLFRIGFKNPVGLAMLQIVKETVEY---------------------------REKHGIVRKDLL 270
            ...|.||        .|:.||.:.:|                           ...||...|.:|
 Worm   395 DSWFNIG--------ALETVKTSTKYGSNAYLGSFDYYNMGSNDPYATWFPFKAANHGSELKYML 451

  Fly   271 QLLIQLRNTGKIDENDEKSFSIQKTPDGHIKTISLEAITAQAFIFYIAGQETTGSTAAFTIYELA 335
            .     ...||....:|:           .|.|.:.......|:.|.......|           
 Worm   452 G-----EGMGKFSPIEEE-----------FKVIDMMGTLTANFVKYGNPNGING----------- 489

  Fly   336 QYPELLKRLQDEVDETLAK------------NDGKI-TYDSLNK 366
              |||.|:...|...:..|            .||:: .::.:||
 Worm   490 --PELWKKYTPEKPYSYFKIDYPKSEMRDNFQDGRLKLFEDINK 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6d4NP_651082.1 p450 58..500 CDD:278495 67/366 (18%)
cest-32NP_504397.1 COesterase 15..516 CDD:278561 65/352 (18%)
Aes <104..>227 CDD:223730
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.