DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cd and Nox4

DIOPT Version :9

Sequence 1:NP_651081.1 Gene:cd / 42681 FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:XP_008757865.1 Gene:Nox4 / 85431 RGDID:620600 Length:623 Species:Rattus norvegicus


Alignment Length:361 Identity:64/361 - (17%)
Similarity:118/361 - (32%) Gaps:99/361 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 RHYRSLSTNPEARKLARRGYVENQATIDIAKRFNYTKQPGRSNIGWGPKIVLPDPTVLRLECDFN 215
            |.||.:.:|.....::...:..:...:.:.|. |:..:||:       .|:|..|:|..||   |
  Rat   298 RLYRCIRSNKPVTIISVINHPSDVMELRMIKE-NFKARPGQ-------YIILHCPSVSALE---N 351

  Fly   216 ARY-----RRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAPRVSHHGRLPPARQVSLKIH 275
            ..:     ..|..||..:.  :.:..::..:..::..|.|....|.::.|...|.|.        
  Rat   352 HPFTLTMIMSSVWVCQKRW--QLWPGTVYIHTSILCGDAARHDYASKIHHALLLCPT-------- 406

  Fly   276 RSSYETDSNFTVMLAVFGQFMDHDITATSLTTSQEGE---------------------------- 312
                ||.:.|.|...|.|.:.:.........:||:.|                            
  Rat   407 ----ETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLN 467

  Fly   313 -SIDCCVAATREQHPECYPVDILPDDPYYKQYNISCMNFVRSAPAPTGRFGPRMQLNQATAFIDA 376
             .:..|||......|....::.|.||  :|.|.:..:.|:...          ..:.....|.|.
  Rat   468 YEVSLCVAGGIGVTPFASILNTLLDD--WKPYKLRRLYFIWVC----------RDIQSFQWFADL 520

  Fly   377 SVVYGNLEQRQNQLRSFINGSLRMFVTDD------------------GRQLLPISSNPADGCNRV 423
            ..|..|...::|: ..|:|..|.:..||.                  ||....:..:....|||.
  Rat   521 LYVLHNKFWQENR-PDFVNIQLYLSQTDGIQKIIGEKYHTLNSRLFIGRPRWKLLFDEIAKCNRG 584

  Fly   424 QMTRLGKYCFESGDDRANENLLLTSMHLLWARHHNY 459
            :  .:|.:|       ...:.:..::|.|..|:::|
  Rat   585 K--TVGVFC-------CGPSSISKTLHNLSNRNNSY 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 49/294 (17%)
peroxinectin_like 364..750 CDD:188655 21/114 (18%)
Nox4XP_008757865.1 Ferric_reduct 69..204 CDD:280043
NOX_Duox_like_FAD_NADP 311..622 CDD:99783 60/348 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.