DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cd and RBOH F

DIOPT Version :10

Sequence 1:NP_651081.1 Gene:cd / 42681 FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_564821.1 Gene:RBOH F / 842710 AraportID:AT1G64060 Length:944 Species:Arabidopsis thaliana


Alignment Length:195 Identity:38/195 - (19%)
Similarity:61/195 - (31%) Gaps:73/195 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 SFRHYRSLSTNPEARKLARRGYVENQATIDIAK---------RFNYTKQPGRSNIGWGPKIVLPD 204
            :.|::||.|.:....|:|.  |..|..|:.::|         ::.:.:.|..|...|.|..:...
plant   616 TLRYFRSGSYSVRLLKVAI--YPGNVLTLQMSKPTQFRYKSGQYMFVQCPAVSPFEWHPFSITSA 678

  Fly   205 PTVLRLECDFNARYRRSTG------------VC----------------NNKQHPR-----TYGA 236
            |     |.|:.:.:.|..|            ||                ..|..|:     .|||
plant   679 P-----EDDYISIHIRQLGDWTQELKRVFSEVCEPPVGGKSGLLRADETTKKSLPKLLIDGPYGA 738

  Fly   237 SMVPYRR-----------------MVSPDYADGIAAPRVSHHGRLPPARQVSLKIHRSSYETDSN 284
            ....||:                 .:..|..:.|.  ::..|     |..:|.....|.|.|.||
plant   739 PAQDYRKYDVLLLVGLGIGATPFISILKDLLNNIV--KMEEH-----ADSISDFSRSSEYSTGSN 796

  Fly   285  284
            plant   797  796

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..762 CDD:460804 21/117 (18%)
RBOH FNP_564821.1 NADPH_Ox 169..267 CDD:462469
FRQ1 203..333 CDD:444056
COG4097 453..>768 CDD:443273 28/158 (18%)
FAD_binding_8 624..740 CDD:285293 23/122 (19%)
NAD_binding_6 746..926 CDD:429792 10/58 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.