DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cd and NOX1

DIOPT Version :9

Sequence 1:NP_651081.1 Gene:cd / 42681 FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_008983.2 Gene:NOX1 / 27035 HGNCID:7889 Length:564 Species:Homo sapiens


Alignment Length:161 Identity:30/161 - (18%)
Similarity:55/161 - (34%) Gaps:67/161 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   708 DQFLRLKLGDSHWYERKMGPQKFTKAQLAEI---YKTSLAAI-ICRNSDGITR---------VRE 759
            |.||:.:..|.::|.||:.......|:.:.:   :.::|..: :|||.....|         :|:
Human    28 DAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRK 92

  Fly   760 HVMQRLRDGGNPHVDCQDLEGFH-------------------FNFEPWSEKQQPQDLHSAGISRG 805
            .:...|.              ||                   |||:.:|..:|..|        |
Human    93 QLDHNLT--------------FHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATD--------G 135

  Fly   806 STSVRVMSKANH------------QAHNVTL 824
            |.: .::|..:|            |:.|.|:
Human   136 SLA-SILSSLSHDEKKGGSWLNPIQSRNTTV 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 12/50 (24%)
peroxinectin_like 364..750 CDD:188655 10/45 (22%)
NOX1NP_008983.2 Ferric_reduct 66..213 CDD:307763 22/123 (18%)
NOX_Duox_like_FAD_NADP 297..564 CDD:99783
Interaction with NOXO1. /evidence=ECO:0000269|PubMed:16329988 397..536
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.