DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cd and Igsf9b

DIOPT Version :9

Sequence 1:NP_651081.1 Gene:cd / 42681 FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:361 Identity:84/361 - (23%)
Similarity:123/361 - (34%) Gaps:111/361 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GYVVLPPYQGPERVFPG------GVSPRARRNKMRQFQCCMGITFIAIVFTALCLALVFSDSLGG 75
            |:|...|.:||....|.      .:.|...:.::|.....|||..:...          ..:..|
Mouse  1108 GWVGKSPGRGPIPAPPATKWQERPMQPLVSQGQLRHTSQGMGIPVLPYP----------EPAEPG 1162

  Fly    76 ADGGPSFFFVVNGSDS---ELAPNRPLPD----------------EPAAEWALQQAALGHHDGAQ 121
            ..||||.|    |.|:   |..| ||.|.                :|:....|.|:.|....|:.
Mouse  1163 GHGGPSTF----GLDTRWYEPQP-RPRPSPRQARRAEPSLHQVVLQPSRLSPLTQSPLSSRTGSP 1222

  Fly   122 AVSAGIK----ALGDREILEEGLQP------NEVNTPSFR---HYRSLSTNPEAR------KLAR 167
            .::|..:    .|...|:.|..|||      :..:|||..   ...|.|.:|..|      .|| 
Mouse  1223 ELAARARPRPGLLQQAEMSEITLQPPAAVSFSRKSTPSSTGSPSQSSRSGSPSYRPTMGFTTLA- 1286

  Fly   168 RGYVENQA---------TIDIAKRFNYTKQP---GRSNIGWGPKIVLPDPTVL-----------R 209
            .||.....         |:|:   |..|..|   |...:...|...||...:|           |
Mouse  1287 TGYPSPPPGPAPPAPGDTLDV---FGQTPSPRRMGEEPLRPEPPTTLPTSGILPPAPGNAAVPER 1348

  Fly   210 LECDFNARYRR-------STGVCNNKQHPRTYG----ASMVPYRRMVSPDYADGIAAPRVSHHGR 263
            ||.   .||:|       |.|  ::|...|:.|    |..:|..:::.||  :.:...:...|.|
Mouse  1349 LEA---LRYQRIKKPKKSSKG--SSKSKKRSDGSASQAQQLPSSQVLWPD--EAVCLRKKKRHSR 1406

  Fly   264 LPPARQVSLKIHRSSYETDSNFTVMLAVFGQFMDHD 299
            ..|..::|...||...|..   |.:|    ..:|||
Mouse  1407 PDPFARLSDLCHRQLPEDQ---TAIL----NSVDHD 1435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 23/93 (25%)
peroxinectin_like 364..750 CDD:188655
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273
I-set 141..227 CDD:369462
Ig 231..323 CDD:386229
Ig <355..416 CDD:386229
Ig 440..504 CDD:319273
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021 35/154 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.