DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cd and CYBB

DIOPT Version :10

Sequence 1:NP_651081.1 Gene:cd / 42681 FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_000388.2 Gene:CYBB / 1536 HGNCID:2578 Length:570 Species:Homo sapiens


Alignment Length:86 Identity:17/86 - (19%)
Similarity:26/86 - (30%) Gaps:36/86 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 TFTTTTPDPRTSPTTPDPSTSTTPKYRISRAELGRILNRNYRGLQKLFRLEWNDAWNQTKYNIDD 154
            ||:..|.:.::.|...:|:             ||             |..:|   ||....|   
Human   303 TFSDGTKECKSCPAGTEPA-------------LG-------------FEYKW---WNVLPAN--- 335

  Fly   155 YKRELKNSAFPPRNKTAGPIN 175
                :|.|.|...|.....:|
Human   336 ----MKTSCFNVGNSKCDGMN 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..762 CDD:460804
CYBBNP_000388.2 Ferric_reduct 65..220 CDD:426438
PLN02844 <165..>423 CDD:215453 17/86 (20%)
NOX_Duox_like_FAD_NADP 297..570 CDD:99783 17/86 (20%)
NAD_binding_6 401..550 CDD:429792
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.