DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and Sash3

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001300678.1 Gene:Sash3 / 74131 MGIID:1921381 Length:381 Species:Mus musculus


Alignment Length:122 Identity:25/122 - (20%)
Similarity:47/122 - (38%) Gaps:24/122 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RAVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVRFLVNAPEQ 68
            :.:.:.|..:.:|::....|..||.::|..|.:..:.|..|.:.:|.||..||...         
Mouse   255 KTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAA--------- 310

  Fly    69 FICKEPCELHEEIELKLDPDVELFASLKCLENVDFLETPVPYSLTSPQKTLTTRDSC 125
                         ||.||.|..  .|.:..|..:..:.||.::::.|:..:.....|
Mouse   311 -------------ELLLDYDTA--GSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGC 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 14/59 (24%)
Sash3NP_001300678.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76
SLY 21..174 CDD:463602
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..168
SH3_SASH3 176..231 CDD:212901
SAM_superfamily 250..317 CDD:472832 18/83 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.