DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and Sash1

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:XP_030101115.1 Gene:Sash1 / 70097 MGIID:1917347 Length:1392 Species:Mus musculus


Alignment Length:132 Identity:33/132 - (25%)
Similarity:61/132 - (46%) Gaps:16/132 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RAVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVRFLVNAPEQ 68
            ::|.|.|..:.:::::..||..||:.::..||:...||..|.:.:|.||.:||..|..|    ::
Mouse   791 KSVEDLLDRINLKEHMPTFLFNGYEDLDTFKLLEEEDLDELNIRDPEHRAVLLTAVELL----QE 851

  Fly    69 FICKEPCELHEEIELKLDPDVELFASLK-----CLENVDFLETPVPYSLTSPQKTLTTRDSCKWN 128
            :.........:|   ||..|.:..:...     |.|:.:.||.    :.|.....|:|:.|.:.|
Mouse   852 YDSNSDQSGSQE---KLLVDNQGLSGRSPRDSGCYESSENLEN----AKTHKPSVLSTKSSTESN 909

  Fly   129 VK 130
            :|
Mouse   910 LK 911

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 19/59 (32%)
Sash1XP_030101115.1 SLY 559..710 CDD:463602
SH3_SASH1 712..768 CDD:212900
SAM_SASH1_repeat1 789..853 CDD:188958 19/65 (29%)
PHA03307 855..>1214 CDD:223039 14/64 (22%)
SAM_SASH1_repeat2 1318..1387 CDD:188891
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.