DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and Samsn1

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_075869.2 Gene:Samsn1 / 67742 MGIID:1914992 Length:372 Species:Mus musculus


Alignment Length:144 Identity:33/144 - (22%)
Similarity:62/144 - (43%) Gaps:36/144 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RAVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVRFLVNAPEQ 68
            :.::::|..:.:::|....|..||::::..|.|..|.||.|.:.:|..|..||       :|.|.
Mouse   244 QTIQEFLERIHLQEYTSTLLLNGYETLDDLKDIKESHLIELNIADPEDRARLL-------SAAES 301

  Fly    69 FICKEPCELHEE--IELKLDPDVELFASLKCLENVDFLETPVPYSLTSPQKTLTTRDS-C----K 126
            .:.:|....||:  :.|..:||:                      |::.|.....||| |    :
Mouse   302 LLDEETTVEHEKESVPLSSNPDI----------------------LSASQLEDCPRDSGCYISSE 344

  Fly   127 WNVKGVDQLPSDNI 140
            .:..|.:.|.|:|:
Mouse   345 NSDNGKEDLESENL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 15/59 (25%)
Samsn1NP_075869.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71
SLY 17..164 CDD:463602
Important for interaction with 14-3-3 proteins 20..25
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..111
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..153
SH3 167..218 CDD:473055
SAM_SAMSN1 239..304 CDD:188960 17/66 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..372 16/77 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.