DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and SAMSN1

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001382787.1 Gene:SAMSN1 / 64092 HGNCID:10528 Length:701 Species:Homo sapiens


Alignment Length:136 Identity:35/136 - (25%)
Similarity:56/136 - (41%) Gaps:41/136 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RAVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVRFLVNAPEQ 68
            :.::::|..:.:::|....|..||:::|..|.|..|.||.|.::||..|:.||       :|.|.
Human   572 KTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESHLIELNIENPDDRRRLL-------SAAEN 629

  Fly    69 FICKEPCELHEEIELKLDPDVELFASLKCLENVDFLETPVPYSLTSPQKTLTTRDSCKWNVKGVD 133
            |       |.|||             ::..||     .|.|.||:|         ....|...:|
Human   630 F-------LEEEI-------------IQEQEN-----EPEPLSLSS---------DISLNKSQLD 660

  Fly   134 QLPSDN 139
            ..|.|:
Human   661 DCPRDS 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 17/59 (29%)
SAMSN1NP_001382787.1 SLY 348..492 CDD:463602
SH3 495..546 CDD:473055
SAM_SAMSN1 567..631 CDD:188960 20/72 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.