DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and sash3

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:XP_690443.4 Gene:sash3 / 561954 ZFINID:ZDB-GENE-130411-1 Length:386 Species:Danio rerio


Alignment Length:115 Identity:26/115 - (22%)
Similarity:41/115 - (35%) Gaps:26/115 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IGKFLE-RGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVRFL-------------VNAPEQF 69
            :|..|. .|:.|:|....:..|.|..|.:.:|..|..:|:....:             ...|...
Zfish   267 LGSLLSMHGFQSLEDFTGLKESHLNDLNITDPEQRVKILKATELIHDSEDESDAEEQKTEMPRDS 331

  Fly    70 ICKEPCE----------LHEEIELKLDPDVE--LFASLKCLENVDFLETP 107
            .|.|..|          :..:.|.:.|||.|  |.|..:.||.:...|:|
Zfish   332 GCYESTENLANEREEPQVDSQAEPETDPDTEIKLNAVQEQLEVMKVEESP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 11/58 (19%)
sash3XP_690443.4 SLY 22..172 CDD:463602
SH3 174..229 CDD:473055
SAM_SASH-like 251..310 CDD:188892 11/42 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.