DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and CG34377

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001262830.1 Gene:CG34377 / 42608 FlyBaseID:FBgn0263117 Length:453 Species:Drosophila melanogaster


Alignment Length:117 Identity:44/117 - (37%)
Similarity:57/117 - (48%) Gaps:12/117 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVRFLVN---APE 67
            |.:||..:.:..|...|||.|||.:|.||.|...||..:|||||:||..||:.||.|..   |..
  Fly    86 VCEWLRTIGLAHYGESFLENGYDELEICKQIGEIDLDAIGVDNPSHRGKLLKSVRMLREKGAAIV 150

  Fly    68 QFICKEPCELHEEIELKLDPDVELFASLKCLENV--DFLE------TPVPYS 111
            ..:..:|..|....|: |..|.:...::|.||.|  ..||      |..|||
  Fly   151 YVLINDPKALSSSNEI-LASDCDTPVTMKELEAVMKRHLEADGIRLTAHPYS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 28/57 (49%)
CG34377NP_001262830.1 SAM_superfamily 84..144 CDD:472832 28/57 (49%)

Return to query results.
Submit another query.