DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and SAMD5

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:XP_016866339.1 Gene:SAMD5 / 389432 HGNCID:21180 Length:189 Species:Homo sapiens


Alignment Length:78 Identity:32/78 - (41%)
Similarity:42/78 - (53%) Gaps:4/78 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCGRAVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVRFL--- 62
            ||...|.:||..|.:.:|...|::.|||.:|.||.|...||..:||..||||:.:||.||.|   
Human     1 MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVRRLREQ 65

  Fly    63 -VNAPEQFICKEP 74
             .||...:...||
Human    66 DANAAGLYFTLEP 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 27/65 (42%)
SAMD5XP_016866339.1 SAM_Samd5 2..64 CDD:188926 27/61 (44%)

Return to query results.
Submit another query.