DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and inppl1b

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001034224.2 Gene:inppl1b / 368433 ZFINID:ZDB-GENE-030616-75 Length:1226 Species:Danio rerio


Alignment Length:54 Identity:17/54 - (31%)
Similarity:29/54 - (53%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGV 59
            ||:.|..|.:::|.......|:|.::....|...:|...||.||:||:.:||.:
Zfish  1168 VRELLSTLGLQRYTLDLSRSGWDDLDYFSGITEEELCAAGVSNPSHRRRILENL 1221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 17/54 (31%)
inppl1bNP_001034224.2 SH2_SHIP 2..104 CDD:198206
EEP 404..707 CDD:469791
SAM_superfamily 1165..1221 CDD:472832 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.