DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and INPPL1

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001427363.1 Gene:INPPL1 / 3636 HGNCID:6080 Length:1280 Species:Homo sapiens


Alignment Length:49 Identity:18/49 - (36%)
Similarity:28/49 - (57%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLE 57
            ||..:.:|:|....:..|:|.:|....|...||...||.:|||::|||:
Human  1226 WLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLD 1274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 18/49 (37%)
INPPL1NP_001427363.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 919..1140
SH3-binding 966..971
NPXY motif 1005..1008
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.