| Sequence 1: | NP_651078.1 | Gene: | CG17625 / 42678 | FlyBaseID: | FBgn0039002 | Length: | 142 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001427363.1 | Gene: | INPPL1 / 3636 | HGNCID: | 6080 | Length: | 1280 | Species: | Homo sapiens |
| Alignment Length: | 49 | Identity: | 18/49 - (36%) |
|---|---|---|---|
| Similarity: | 28/49 - (57%) | Gaps: | 0/49 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 9 WLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLE 57 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17625 | NP_651078.1 | SAM_Samd5 | 2..64 | CDD:188926 | 18/49 (37%) |
| INPPL1 | NP_001427363.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 919..1140 | ||
| SH3-binding | 966..971 | ||||
| NPXY motif | 1005..1008 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||