DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and C46H3.2

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001317737.1 Gene:C46H3.2 / 3564865 WormBaseID:WBGene00016725 Length:920 Species:Caenorhabditis elegans


Alignment Length:54 Identity:22/54 - (40%)
Similarity:33/54 - (61%) Gaps:5/54 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DWLVLLTMEKYIGKFLERGYD--SIERCKLIIVSDLIMLGVDNPAHRKLLLEGV 59
            :||..:.|..|:..||::|||  :|.||   ..:||:.||:.||.|||.|:..:
 Worm   547 NWLDSINMSNYLAVFLKQGYDLQTIARC---TPADLLSLGIKNPDHRKKLMSDI 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 22/54 (41%)
C46H3.2NP_001317737.1 ANKYR 24..259 CDD:440430
ANK repeat 29..61 CDD:293786
ANK repeat 63..94 CDD:293786
ANK repeat 96..127 CDD:293786
ANK repeat 129..153 CDD:293786
ANK repeat 165..197 CDD:293786
ANK repeat 199..229 CDD:293786
SH3 266..321 CDD:214620
SAM_caskin1,2_repeat1 539..604 CDD:188896 22/54 (41%)
SAM_caskin1,2_repeat2 606..676 CDD:188897
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.