DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and samsn1a

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001122141.1 Gene:samsn1a / 336695 ZFINID:ZDB-GENE-030131-8639 Length:621 Species:Danio rerio


Alignment Length:78 Identity:22/78 - (28%)
Similarity:32/78 - (41%) Gaps:10/78 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVRFLVNAPEQFICKEPCEL 77
            |.:|:|....|..||.:::..:.:....||.|.|.:|.||..||....          |......
Zfish   535 LHLEEYASSLLLNGYQTVDDLRHLKERHLIELNVTDPEHRHRLLAASD----------CLYVTNK 589

  Fly    78 HEEIELKLDPDVE 90
            .||.|:|.|.:.|
Zfish   590 EEEGEMKGDDEDE 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 15/50 (30%)
samsn1aNP_001122141.1 SLY 307..442 CDD:463602
SH3_SASH_like 445..496 CDD:212756
SAM_superfamily 521..584 CDD:472832 15/58 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.