DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and Samd5

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:XP_017169459.1 Gene:Samd5 / 320825 MGIID:2444815 Length:182 Species:Mus musculus


Alignment Length:62 Identity:27/62 - (43%)
Similarity:36/62 - (58%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCGRAVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVRFL 62
            ||...|.:||..|.:.:|...|::.|||.:|.||.|...||..:||..||||:.:||.|..|
Mouse     1 MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVHRL 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 26/61 (43%)
Samd5XP_017169459.1 SAM_Samd5 2..64 CDD:188926 26/61 (43%)

Return to query results.
Submit another query.