DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and ephb4a

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_571489.1 Gene:ephb4a / 30688 ZFINID:ZDB-GENE-990415-62 Length:987 Species:Danio rerio


Alignment Length:61 Identity:23/61 - (37%)
Similarity:33/61 - (54%) Gaps:1/61 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CGRAVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVRFL 62
            || .|.|||..:.||:|...||:.||.|::....|...||:.||:....|:|.:|..:..|
Zfish   916 CG-TVGDWLRAIKMERYEETFLQAGYTSMQLVTHINTEDLLRLGITLAGHQKKILSSIEAL 975

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 23/61 (38%)
ephb4aNP_571489.1 EphR_LBD 26..199 CDD:470656
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..340
fn3 339..418 CDD:394996
FN3 440..533 CDD:238020
EphA2_TM 547..618 CDD:464211
PTKc_EphR_B 616..884 CDD:173638
SAM_EPH-B4 914..980 CDD:188953 23/61 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.