DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and EPHA10

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001092909.1 Gene:EPHA10 / 284656 HGNCID:19987 Length:1008 Species:Homo sapiens


Alignment Length:58 Identity:20/58 - (34%)
Similarity:29/58 - (50%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVRFL 62
            :|..||..|.:.:|...|...||.|:|....:...||:.||:....||:.||.|:..|
Human   937 SVGAWLEALDLCRYKDSFAAAGYGSLEAVAEMTAQDLVSLGISLAEHREALLSGISAL 994

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 20/58 (34%)
EPHA10NP_001092909.1 EphR_LBD_A10 35..210 CDD:198455
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 322..342
fn3 339..431 CDD:394996
FN3 451..531 CDD:214495
EphA2_TM 569..642 CDD:464211
PTKc_EphR_A10 639..904 CDD:133195
SAM_superfamily 929..998 CDD:472832 20/58 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.