DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and SASH1

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:XP_016866087.1 Gene:SASH1 / 23328 HGNCID:19182 Length:1410 Species:Homo sapiens


Alignment Length:59 Identity:19/59 - (32%)
Similarity:34/59 - (57%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RAVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVRFL 62
            ::|.|.|..:.:::::..||..||:.::..||:...||..|.:.:|.||.:||..|..|
Human   799 KSVEDLLDRINLKEHMPTFLFNGYEDLDTFKLLEEEDLDELNIRDPEHRAVLLTAVELL 857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 19/59 (32%)
SASH1XP_016866087.1 SLY 567..718 CDD:463602
SH3_SASH1 720..776 CDD:212900
SAM_SASH1_repeat1 796..861 CDD:188958 19/59 (32%)
Atrophin-1 1007..>1249 CDD:460830
SAM_SASH1_repeat2 1336..1405 CDD:188891
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.