DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and EPHA5

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001268694.1 Gene:EPHA5 / 2044 HGNCID:3389 Length:1038 Species:Homo sapiens


Alignment Length:57 Identity:18/57 - (31%)
Similarity:32/57 - (56%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RAVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVR 60
            |:|.:||..:.|.:|...|:|.||.|::....:.:.||..|||....|:|.::..::
Human   969 RSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIMNSLQ 1025

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 18/57 (32%)
EPHA5NP_001268694.1 EphR_LBD_A5 60..232 CDD:198451
FN3 <355..>598 CDD:442628
FN3 469..559 CDD:238020
EphA2_TM 576..673 CDD:464211
PTKc_EphR_A 671..937 CDD:270651
SAM_EPH-A5 966..1031 CDD:188945 18/57 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.