DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and Samsn1

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_570834.2 Gene:Samsn1 / 170637 RGDID:620926 Length:372 Species:Rattus norvegicus


Alignment Length:88 Identity:26/88 - (29%)
Similarity:46/88 - (52%) Gaps:9/88 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RAVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVRFLVNAPEQ 68
            :.::::|..:.:::|...||..||::::..|.|..|.||.|.:.||..|..||       :|.|.
  Rat   244 QTLQEFLERIHLQEYTSAFLLNGYEALDDLKDIKESHLIELNIANPEDRARLL-------SAAES 301

  Fly    69 FICKEPCELHEE--IELKLDPDV 89
            .:.:|....|||  :.|..:||:
  Rat   302 LLDEETAAEHEEEPVPLSSNPDI 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 17/59 (29%)
Samsn1NP_570834.2 SLY 17..164 CDD:463602
SH3 167..218 CDD:473055
SAM_SAMSN1 239..304 CDD:188960 19/66 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.