DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and Inppl1

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_034697.2 Gene:Inppl1 / 16332 MGIID:1333787 Length:1257 Species:Mus musculus


Alignment Length:49 Identity:18/49 - (36%)
Similarity:28/49 - (57%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLE 57
            ||..:.:|:|....:..|:|.:|....|...||...||.:|||::|||:
Mouse  1203 WLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLD 1251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 18/49 (37%)
Inppl1NP_034697.2 SH2_SHIP 17..119 CDD:198206
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..181
INPP5c_SHIP2-INPPL1 425..728 CDD:197335
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 897..986
SH3-binding 945..950
NPXY motif 984..987
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 999..1119
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1134..1196
SAM_Ship2 1193..1255 CDD:188890 18/49 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.