DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and Epha7

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_034271.3 Gene:Epha7 / 13841 MGIID:95276 Length:998 Species:Mus musculus


Alignment Length:56 Identity:16/56 - (28%)
Similarity:32/56 - (57%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVR 60
            :|.:||..:.||:|...|...||:|:|....:.:.|::.||:....|:|.::..::
Mouse   927 SVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIDDVMSLGITLVGHQKKIMSSIQ 982

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 16/56 (29%)
Epha7NP_034271.3 EphR_LBD_A7 30..206 CDD:198453
FN3 <314..>549 CDD:442628
FN3 443..534 CDD:238020
EphA2_TM 565..630 CDD:464211
PTKc_EphR_A 628..894 CDD:270651
SAM_EPH-A7 919..988 CDD:188947 16/56 (29%)
PDZ-binding. /evidence=ECO:0000255 996..998
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.