DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and Epha5

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:XP_006534832.1 Gene:Epha5 / 13839 MGIID:99654 Length:1040 Species:Mus musculus


Alignment Length:57 Identity:18/57 - (31%)
Similarity:32/57 - (56%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RAVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVR 60
            |:|.:||..:.|.:|...|:|.||.|::....:.:.||..|||....|:|.::..::
Mouse   971 RSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIMSSLQ 1027

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 18/57 (32%)
Epha5XP_006534832.1 EphR_LBD 62..234 CDD:470656
FN3 <357..>600 CDD:442628
FN3 471..561 CDD:238020
EphA2_TM 578..675 CDD:464211
PTKc_EphR_A 673..939 CDD:270651
SAM_EPH-A5 968..1033 CDD:188945 18/57 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.