DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17625 and Epha2

DIOPT Version :10

Sequence 1:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_034269.2 Gene:Epha2 / 13836 MGIID:95278 Length:977 Species:Mus musculus


Alignment Length:64 Identity:21/64 - (32%)
Similarity:35/64 - (54%) Gaps:3/64 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RAVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLL---LEGVRFLVN 64
            |.|.:||..:.|::|...|:..||.:||:...:...|:..:||..|.|:|.:   |.|::..||
Mouse   908 RTVSEWLESIKMQQYTEHFMVAGYTAIEKVVQMSNEDIKRIGVRLPGHQKRIAYSLLGLKDQVN 971

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 19/62 (31%)
Epha2NP_034269.2 Mediates interaction with CLDN4. /evidence=ECO:0000250 1..205
EphR_LBD_A2 27..200 CDD:198448
fn3 331..425 CDD:394996
fn3 439..520 CDD:394996
EphA2_TM <570..611 CDD:464211
Mediates interaction with ARHGEF16. /evidence=ECO:0000250 607..907
Protein Kinases, catalytic domain 608..876 CDD:473864
Negatively regulates interaction with ARHGEF16. /evidence=ECO:0000250 887..977 21/64 (33%)
SAM_EPH-A2 903..972 CDD:188942 21/64 (33%)
PDZ-binding. /evidence=ECO:0000255 975..977
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.