| Sequence 1: | NP_651078.1 | Gene: | CG17625 / 42678 | FlyBaseID: | FBgn0039002 | Length: | 142 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_034269.2 | Gene: | Epha2 / 13836 | MGIID: | 95278 | Length: | 977 | Species: | Mus musculus |
| Alignment Length: | 64 | Identity: | 21/64 - (32%) |
|---|---|---|---|
| Similarity: | 35/64 - (54%) | Gaps: | 3/64 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 RAVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLL---LEGVRFLVN 64 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17625 | NP_651078.1 | SAM_Samd5 | 2..64 | CDD:188926 | 19/62 (31%) |
| Epha2 | NP_034269.2 | Mediates interaction with CLDN4. /evidence=ECO:0000250 | 1..205 | ||
| EphR_LBD_A2 | 27..200 | CDD:198448 | |||
| fn3 | 331..425 | CDD:394996 | |||
| fn3 | 439..520 | CDD:394996 | |||
| EphA2_TM | <570..611 | CDD:464211 | |||
| Mediates interaction with ARHGEF16. /evidence=ECO:0000250 | 607..907 | ||||
| Protein Kinases, catalytic domain | 608..876 | CDD:473864 | |||
| Negatively regulates interaction with ARHGEF16. /evidence=ECO:0000250 | 887..977 | 21/64 (33%) | |||
| SAM_EPH-A2 | 903..972 | CDD:188942 | 21/64 (33%) | ||
| PDZ-binding. /evidence=ECO:0000255 | 975..977 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||