DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loco and RGS6

DIOPT Version :9

Sequence 1:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster
Sequence 2:XP_024305527.1 Gene:RGS6 / 9628 HGNCID:10002 Length:684 Species:Homo sapiens


Alignment Length:335 Identity:92/335 - (27%)
Similarity:136/335 - (40%) Gaps:75/335 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   751 SSPVRRTASMNASDNDMYIKTLMLDSDLKSSRSQHQLSLLQVPKV----LTTPAPPSA--ITASV 809
            |.|:|:|...:......::...:....||.|:....|.......|    |.|||.||.  |:..|
Human   250 SQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYDPLITPAEPSNPWISDDV 314

  Fly   810 A---AEGAAQDHGCPSS-----WAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTACE--RYR 864
            |   .|.:.:    ||.     |..||:.:|:|..|...|..||:.|||:||:.||.|.:  :.:
Human   315 ALWDIEMSKE----PSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQ 375

  Fly   865 LLESEADRVAQAREIFAKHLANNSSDPVNVDSQARSLTEEKLADAAPDIFAPAQKQIFSLMKFDS 929
            .|:..|.||   .||:.:.||..:...:|:||.:..:|.:.:.|.....|..||:.|:.|||.||
Human   376 PLQDVAKRV---EEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDS 437

  Fly   930 YQRFIRSDLYKSCVEAEQKNQPLPYSGLDLDELLKTNFHLGAFSKLKKSASNAEDRRRKSLLPWH 994
            |.||:||:.|:..:.|::|.:                               :|..||.||   .
Human   438 YARFLRSNAYQDLLLAKKKPE-------------------------------SEQGRRTSL---E 468

  Fly   995 RKTRSKSRDRTEIMADMQHALMPAPPV------PQNAPLTSASLKLVCGQNSLSDLHSSRSSLSS 1053
            :.|||.:...|. .|......|.|.|:      |::....|.|..|     .|..||      ..
Human   469 KFTRSVNVQNTR-PAGAWSIFMAALPMAVWLRTPRSCHGLSESRLL-----GLPSLH------DG 521

  Fly  1054 FDAGTATGGQ 1063
            ...|...|||
Human   522 LREGKVAGGQ 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492
PTB_RGS12 251..391 CDD:269984
RGS_R12-like 828..941 CDD:188661 43/114 (38%)
RGS12_RBD 1073..1145 CDD:176412
RBD 1144..1213 CDD:128731
RGS6XP_024305527.1 DEP_RGS7-like 31..119 CDD:239897
GGL 258..319 CDD:128520 14/60 (23%)
RGS_RGS6 328..452 CDD:188691 45/126 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.