DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loco and CYTIP

DIOPT Version :9

Sequence 1:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_004279.3 Gene:CYTIP / 9595 HGNCID:9506 Length:359 Species:Homo sapiens


Alignment Length:336 Identity:70/336 - (20%)
Similarity:130/336 - (38%) Gaps:89/336 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SGPAPISTSTTPSGSNSQQHQRR--------------RKKRA--------NYNYNGIRTVEVRRG 77
            :||| .|:.:|.:||.:....||              ||:.|        :::::..:.|.|.:.
Human    20 AGPA-YSSYSTLTGSLTMDDNRRIQMLADTVATLPRGRKQLALTRSSSLSDFSWSQRKLVTVEKQ 83

  Fly    78 YN-GFGFTISGQQP-----C-----RLSC-IISSSPAEQAGLRSGDFLISVNGLNVSKLPHETVV 130
            .| .|||.|...:|     |     .|.| |...|||..|||::||.|.::||::.....::.||
Human    84 DNETFGFEIQSYRPQNQNACSSEMFTLICKIQEDSPAHCAGLQAGDVLANINGVSTEGFTYKQVV 148

  Fly   131 QLIGNSFGSIRMQIAENYYSDSSDEENAHATLRGQLLAASLRHKPRFLHHKAKLHRLRNSPQKKL 195
            .||.:|...:.::                 ||.|.::.       :....:|||..|:.:.::|.
Human   149 DLIRSSGNLLTIE-----------------TLNGTMIL-------KRTELEAKLQVLKQTLKQKW 189

  Fly   196 NPPEAVEPHKSKSSPDHPTLKPVLEDPPLTANLSKAADVANVSAMVRAVGSAALE---------C 251
                 || ::|....:|..|.....:.|...|:.  .|..::...:...|.|.::         |
Human   190 -----VE-YRSLQLQEHRLLHGDAANCPSLENMD--LDELSLFGPLPGPGPALVDRNRLSSESSC 246

  Fly   252 RVIVGYLGTIEMPKQISHSSKLQTVRSCIRKLRQEKRQPTIVLMCITPDSLSLQSSSGGVLATYS 316
            :   .:|.::.|..:..:       ::|:   .::..:........|.|...:.......|...|
Human   247 K---SWLSSMTMDSEDGY-------QTCV---SEDSSRGAFSRQTSTDDECFIPKEGDDFLRRSS 298

  Fly   317 SARLNFVSSSS 327
            |.|...:|::|
Human   299 SRRNRSISNTS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492 28/87 (32%)
PTB_RGS12 251..391 CDD:269984 12/77 (16%)
RGS_R12-like 828..941 CDD:188661
RGS12_RBD 1073..1145 CDD:176412
RBD 1144..1213 CDD:128731
CYTIPNP_004279.3 PDZ_signaling 76..161 CDD:238492 28/84 (33%)
Interaction with CYTH1 166..188 4/28 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.