DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loco and Rgs10

DIOPT Version :9

Sequence 1:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster
Sequence 2:XP_006508202.1 Gene:Rgs10 / 67865 MGIID:1915115 Length:185 Species:Mus musculus


Alignment Length:161 Identity:65/161 - (40%)
Similarity:94/161 - (58%) Gaps:5/161 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   797 TTPAPPSAITASVAAEGAA----QDHGCPSSWAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFW 857
            |..||.|.:......:|::    |.....:.||.|.|.:|:|..|:|.|.||||||||.||:.||
Mouse    11 TAEAPDSVLRDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDPEGVQRFREFLKKEFSEENVLFW 75

  Fly   858 TACERYRLLESEADRVAQAREIFAKHLANNSSDPVNVDSQARSLTEEKLADAAPDIFAPAQKQIF 922
            .|||.::..|.......:|:||:...|:|.:|..|||:.|:| |||:.|.:..|.:|...|.|||
Mouse    76 LACEDFKKTEDRKQMQEKAKEIYMTFLSNKASSQVNVEGQSR-LTEKILEEPHPLMFQKLQDQIF 139

  Fly   923 SLMKFDSYQRFIRSDLYKSCVEAEQKNQPLP 953
            :|||:|||.||::|||:......|::.:..|
Mouse   140 NLMKYDSYSRFLKSDLFLKPKRTEEEEEEPP 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492
PTB_RGS12 251..391 CDD:269984
RGS_R12-like 828..941 CDD:188661 54/112 (48%)
RGS12_RBD 1073..1145 CDD:176412
RBD 1144..1213 CDD:128731
Rgs10XP_006508202.1 RGS_RGS10 46..158 CDD:188695 54/112 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850627
Domainoid 1 1.000 117 1.000 Domainoid score I5880
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D144440at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.