DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loco and Slc9a3r2

DIOPT Version :9

Sequence 1:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_075542.2 Gene:Slc9a3r2 / 65962 MGIID:1890662 Length:337 Species:Mus musculus


Alignment Length:304 Identity:72/304 - (23%)
Similarity:118/304 - (38%) Gaps:69/304 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 RTVEVRRGYNGFGFTISGQQPCR---LSCIISSSPAEQAGLRSGDFLISVNGLNVSKLPHETVVQ 131
            |...:.||..|:||.:.|::..|   :..:...||||.|.||:||.|:.|||:||....|..|||
Mouse    10 RLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQ 74

  Fly   132 LIGNSFGSIRMQIAENYYSD-------SSDEENAHATL----------------------RGQLL 167
            .|....|..::.:.:....:       :..||.||..|                      .||  
Mouse    75 RIKAVEGQTQLLVVDKETDEELCRRQLTCTEEMAHRGLPPAHNPWEPKPDWACSGSLGSDTGQ-- 137

  Fly   168 AASLRHKPRFLHHKAKLHRLRNSPQ--------KKLNPPEAVEPHKSKSSPDHPTLKPVLEDPPL 224
             ..:...||.|  :.:|..||..||        .|..|.:.:......|...|..|:  .:|..:
Mouse   138 -KDVNGPPREL--RPRLCHLRRGPQGYGFNLHSDKSRPGQYIRSVDPGSPASHSGLR--AQDRLI 197

  Fly   225 TANLSKAADV--ANVSAMVRAVGSAALECRVIVGYLGTIEMPKQISHSSKLQTVRSCIRKLRQEK 287
            ..|......:  |.|.|.::|...   |.|::|     :: |:...|..:|:.:.:   :...|.
Mouse   198 EVNGQNVEGLRHAEVVARIKAQED---EARLLV-----VD-PETDEHFKRLRVIPT---EEHVEG 250

  Fly   288 RQPTIVLMCITPDSLSLQSSSGGVLATYSSARLNFVSSSSESEN 331
            ..|:.|....:|..|     :||   :..|:|.:...|..::|:
Mouse   251 PLPSPVTNGTSPAQL-----NGG---SVCSSRSDLPGSEKDNED 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492 29/77 (38%)
PTB_RGS12 251..391 CDD:269984 16/81 (20%)
RGS_R12-like 828..941 CDD:188661
RGS12_RBD 1073..1145 CDD:176412
RBD 1144..1213 CDD:128731
Slc9a3r2NP_075542.2 PDZ_signaling 9..88 CDD:238492 29/77 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..147 5/37 (14%)
PDZ 148..230 CDD:214570 19/92 (21%)
EBP50_C 232..337 CDD:286142 13/66 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..337 11/56 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.