DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loco and Synj2bp

DIOPT Version :9

Sequence 1:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_072121.2 Gene:Synj2bp / 64531 RGDID:69400 Length:145 Species:Rattus norvegicus


Alignment Length:83 Identity:25/83 - (30%)
Similarity:42/83 - (50%) Gaps:10/83 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 VEVRRGYNGFGFTISG---QQ------PCRLSCIISSSPAEQAG-LRSGDFLISVNGLNVSKLPH 126
            :.:.||.:|.||.|.|   ||      ...:|.|.....|.:.| |:.||.::||||.::..|.|
  Rat    14 INLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKEDGAAARDGRLQEGDKILSVNGQDLKNLLH 78

  Fly   127 ETVVQLIGNSFGSIRMQI 144
            :..|.|..|:..::.:::
  Rat    79 QDAVDLFRNAGYAVSLRV 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492 25/83 (30%)
PTB_RGS12 251..391 CDD:269984
RGS_R12-like 828..941 CDD:188661
RGS12_RBD 1073..1145 CDD:176412
RBD 1144..1213 CDD:128731
Synj2bpNP_072121.2 PDZ_signaling 13..97 CDD:238492 25/83 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.