DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment loco and RGS2

DIOPT Version :9

Sequence 1:	NP_732773.1	Gene:	loco / 42672	FlyBaseID:	FBgn0020278	Length:	1541	Species:	Drosophila melanogaster
Sequence 2:	NP_002914.1	Gene:	RGS2 / 5997	HGNCID:	9998	Length:	211	Species:	Homo sapiens

Alignment Length:	129	Identity:	42/129 - (32%)
Similarity:	74/129 - (57%)	Gaps:	1/129 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   824 WAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTACERYRLLESEADRVAQAREIFAKHLANNS 888
            |:.:|:.:|....|:..|..|||.||..|||.||.|||.::..:|.....::||:|:...:...:
Human    80 WSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEA 144

  Fly   889 SDPVNVDSQARSLTEEKLADAAPDIFAPAQKQIFSLMKFDSYQRFIRSDLYKS-CVEAEQKNQP 951
            ...:|:|.|.::|..:.:.:|....|..|||:::|||:.:||.||:.|:.|:. |.:.:...:|
Human   145 PKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEP 208

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
loco	NP_732773.1	PDZ_signaling	69..145	CDD:238492
		PTB_RGS12	251..391	CDD:269984
		RGS_R12-like	828..941	CDD:188661	39/112 (35%)
		RGS12_RBD	1073..1145	CDD:176412
		RBD	1144..1213	CDD:128731
RGS2	NP_002914.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	14..33
		Necessary for membrane association. /evidence=ECO:0000269\|PubMed:11278586	32..66
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	49..68
		Necessary to inhibit protein synthesis. /evidence=ECO:0000269\|PubMed:19736320	79..116		15/35 (43%)
		RGS_RGS2	84..197	CDD:188664	39/112 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3589
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810