DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loco and Rgs20

DIOPT Version :9

Sequence 1:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_001171266.1 Gene:Rgs20 / 58175 MGIID:1929866 Length:372 Species:Mus musculus


Alignment Length:260 Identity:75/260 - (28%)
Similarity:112/260 - (43%) Gaps:57/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   703 LEATNSEPDLGNRALPANASP------------FRRAWGQSSFRTPRSDKVAKEQQQLGQSSPV- 754
            |.:.|||| .|..|....:||            .|:..|.|..:.|      ...||.|:.|.. 
Mouse   135 LASPNSEP-RGEDACTEKSSPESPEGSERTEMRMRQMCGGSETQGP------APSQQGGRGSNAC 192

  Fly   755 ------RRTASMNASDNDMYIKTLMLDSDLKSSRSQHQLSLLQVPKVLTTPAPPSAITASVAAEG 813
                  ..|.|         ..|:....|.:..|:.|::. ..:|....:|.|            
Mouse   193 CFCWCCCCTCS---------CLTVRNQEDQRPQRASHEIR-TDIPACEESPTP------------ 235

  Fly   814 AAQDHGCPSSWAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTACERYRLLESEADRVA---Q 875
             ..:..|  :||.||:.::...||...|.|||:.|||.||:.||.|||.   |:.||::..   :
Mouse   236 -TLEEVC--AWAQSFDNLMVTPAGRNAFREFLRTEFSEENMLFWMACEE---LKREANKSTIEEK 294

  Fly   876 AREIFAKHLANNSSDPVNVDSQARSLTEEKLADAAPDIFAPAQKQIFSLMKFDSYQRFIRSDLYK 940
            ||.|:..:::..|...|::||:.|.:....:.|.:..||..||.||::||..|||.||:.|.:||
Mouse   295 ARIIYEDYISILSPKEVSLDSRVREVINRNMVDPSQHIFDDAQLQIYTLMHRDSYPRFMNSTVYK 359

  Fly   941  940
            Mouse   360  359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492
PTB_RGS12 251..391 CDD:269984
RGS_R12-like 828..941 CDD:188661 45/116 (39%)
RGS12_RBD 1073..1145 CDD:176412
RBD 1144..1213 CDD:128731
Rgs20NP_001171266.1 RGS 205..360 CDD:295367 56/174 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.