DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loco and lnx1

DIOPT Version :9

Sequence 1:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster
Sequence 2:XP_005160562.1 Gene:lnx1 / 561226 ZFINID:ZDB-GENE-030131-9439 Length:769 Species:Danio rerio


Alignment Length:85 Identity:27/85 - (31%)
Similarity:43/85 - (50%) Gaps:11/85 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 RTVEVRRGYNG-FGFTISGQQPCRLSC--------IISSSPAEQAG-LRSGDFLISVNGLNVSKL 124
            :.:.:||..:| .||:|.|.|. .|:|        |:..:||...| :|.||.|:.|||.:...:
Zfish   678 KDIVLRRSTSGSLGFSIVGGQE-ELNCNQSFFIRSIVEGTPAYNDGRIRCGDILLEVNGKSTWGM 741

  Fly   125 PHETVVQLIGNSFGSIRMQI 144
            .|..:|:|:....|.|.:.|
Zfish   742 THTALVRLLKELRGRITLTI 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492 27/85 (32%)
PTB_RGS12 251..391 CDD:269984
RGS_R12-like 828..941 CDD:188661
RGS12_RBD 1073..1145 CDD:176412
RBD 1144..1213 CDD:128731
lnx1XP_005160562.1 RING 57..93 CDD:214546
PDZ_signaling 297..381 CDD:238492
PDZ_signaling 411..491 CDD:238492
PDZ_signaling 536..621 CDD:238492
DegQ <548..621 CDD:223343
PDZ_signaling 678..762 CDD:238492 27/85 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.