DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loco and Rgs10

DIOPT Version :9

Sequence 1:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_062210.1 Gene:Rgs10 / 54290 RGDID:3562 Length:181 Species:Rattus norvegicus


Alignment Length:159 Identity:63/159 - (39%)
Similarity:95/159 - (59%) Gaps:2/159 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   796 LTTPAPPSAI-TASVAAEGAAQDHGCPSSWAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTA 859
            |:...|||.| ....::..:.|.....:.||.|.|.:|:|..|::.|.||||||||.||:.||.|
  Rat     9 LSRKRPPSDIHDGDGSSSSSHQSLKSTAKWASSLENLLEDPEGVKRFREFLKKEFSEENVLFWLA 73

  Fly   860 CERYRLLESEADRVAQAREIFAKHLANNSSDPVNVDSQARSLTEEKLADAAPDIFAPAQKQIFSL 924
            ||.::..|.:.....:|::|:...|:|.:|..|||:.|:| |||:.|.:..|.:|...|.|||:|
  Rat    74 CEDFKKTEDKKQMQEKAKKIYMTFLSNKASSQVNVEGQSR-LTEKILEEPHPLMFQKLQDQIFNL 137

  Fly   925 MKFDSYQRFIRSDLYKSCVEAEQKNQPLP 953
            ||:|||.||::|||:......|::.:..|
  Rat   138 MKYDSYSRFLKSDLFLKHRRTEEEEEDPP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492
PTB_RGS12 251..391 CDD:269984
RGS_R12-like 828..941 CDD:188661 52/112 (46%)
RGS12_RBD 1073..1145 CDD:176412
RBD 1144..1213 CDD:128731
Rgs10NP_062210.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 6/25 (24%)
RGS_RGS10 42..154 CDD:188695 52/112 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..181 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354325
Domainoid 1 1.000 117 1.000 Domainoid score I5761
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D144440at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.