DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loco and PDZK1

DIOPT Version :9

Sequence 1:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster
Sequence 2:XP_024303384.1 Gene:PDZK1 / 5174 HGNCID:8821 Length:539 Species:Homo sapiens


Alignment Length:306 Identity:76/306 - (24%)
Similarity:131/306 - (42%) Gaps:75/306 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 RTVEVRRGYNGFGFTI---SGQQPCRLSCIISSSPAEQAGLRSGDFLISVNGLNVSKLPHETVVQ 131
            |.||:::|.||:||.:   |.|:...:..|.|.||||:|||::.|.:::|||.:|..|.|::||:
Human   262 RIVEMKKGSNGYGFYLRAGSEQKGQIIKDIDSGSPAEEAGLKNNDLVVAVNGESVETLDHDSVVE 326

  Fly   132 LIGNSFGSIRMQIAENYYSDSSDEENAHATLRGQLLAASLRHKPRFLHHKAKLHRLRNSPQKKLN 196
            :|........:.:.:      .:.:|.:          .|.|...||:::::  .|.|...|:..
Human   327 MIRKGGDQTSLLVVD------KETDNMY----------RLAHFSPFLYYQSQ--ELPNGSVKEAP 373

  Fly   197 PP-----EAVEPHKSKSSPDHPTLKPVLEDPPLTANLSKAAD--VANVSAMVRAVGS-------- 246
            .|     |...|..:....||   ||.|      ..|:|..:  ..:::|:....||        
Human   374 APTPTSLEVSSPPDTTEEVDH---KPKL------CRLAKGENGYGFHLNAIRGLPGSFIKEVQKG 429

  Fly   247 -----AALECR---VIVGYLGTIEMP-----KQISHSSKLQTVRSCIRKLR---QEKRQPTIVLM 295
                 |.||..   :.|..:..::.|     .:|..|.|..|:..|.:|..   |.|:.|.:..:
Human   430 GPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGKKAYDYFQAKKIPIVSSL 494

  Fly   296 C----ITPDS---LSLQSSSGGVLA---TYSSARLNFVSSSSESEN 331
            .    ..|||   :.::|:....:|   .:|:|.    .|||.||:
Human   495 ADPLDTPPDSKEGIVVESNHDSHMAKERAHSTAS----HSSSNSED 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492 29/77 (38%)
PTB_RGS12 251..391 CDD:269984 23/102 (23%)
RGS_R12-like 828..941 CDD:188661
RGS12_RBD 1073..1145 CDD:176412
RBD 1144..1213 CDD:128731
PDZK1XP_024303384.1 PDZ_signaling 27..107 CDD:238492
PDZ 152..232 CDD:214570
PDZ_signaling 261..340 CDD:238492 29/77 (38%)
PDZ 395..475 CDD:214570 17/85 (20%)
F1-ATPase_gamma <457..>501 CDD:320933 9/43 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.