powered by:
Protein Alignment loco and pdzd11
DIOPT Version :9
Sequence 1: | NP_732773.1 |
Gene: | loco / 42672 |
FlyBaseID: | FBgn0020278 |
Length: | 1541 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_998122.1 |
Gene: | pdzd11 / 405893 |
ZFINID: | ZDB-GENE-040426-2544 |
Length: | 142 |
Species: | Danio rerio |
Alignment Length: | 69 |
Identity: | 21/69 - (30%) |
Similarity: | 37/69 - (53%) |
Gaps: | 5/69 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 RTVEVRRGYNG-FGFTISGQQPCRLSCIIS----SSPAEQAGLRSGDFLISVNGLNVSKLPHETV 129
||:.:::.... .||.|.|.:..:|...|| .|.|.:|||:.||.::|||.::...:.|...
Zfish 48 RTIVLKKPPGAQLGFNIRGGKASQLGIFISKVVPDSDAHRAGLQEGDQVLSVNEVDFQDIEHSRA 112
Fly 130 VQLI 133
|:::
Zfish 113 VEIL 116
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.