DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loco and Lnx2

DIOPT Version :9

Sequence 1:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_001101799.1 Gene:Lnx2 / 360761 RGDID:1308222 Length:686 Species:Rattus norvegicus


Alignment Length:171 Identity:42/171 - (24%)
Similarity:67/171 - (39%) Gaps:47/171 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LPITGASGSTAVG---TGAAA------------AEDASPAANSGPAPIS-----TSTTPS----- 47
            :.:|..|.|.||.   ..||:            ||:|:.|....|...|     .|.:||     
  Rat   521 IDLTNLSHSEAVAMLKASAASPAVILKALEVQIAEEAAQATEEQPGAFSENEYDASWSPSWVMWL 585

  Fly    48 GSNSQQHQRRRKKRANYNYNGIRTVEVRRGYNG-FGFTISG-------QQPCRLSCIISSSPAEQ 104
            |..|..|             ....:.:||.|.| :||:|.|       .||..:..|:..:||..
  Rat   586 GLPSALH-------------SCHDIVLRRSYLGSWGFSIVGGYEENHSNQPFFIKTIVLGTPAYY 637

  Fly   105 AG-LRSGDFLISVNGLNVSKLPHETVVQLIGNSFGSIRMQI 144
            .| |:.||.:::||||:...:.|..:|.::......:.:.:
  Rat   638 DGRLKCGDMIVAVNGLSTVGMSHSALVPMLKEQRNKVTLTV 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492 23/85 (27%)
PTB_RGS12 251..391 CDD:269984
RGS_R12-like 828..941 CDD:188661
RGS12_RBD 1073..1145 CDD:176412
RBD 1144..1213 CDD:128731
Lnx2NP_001101799.1 mRING-HC-C3HC3D_LNX2 46..90 CDD:319694
PDZ 229..315 CDD:214570
PDZ 335..421 CDD:214570
PDZ_signaling 462..538 CDD:238492 5/16 (31%)
PDZ_signaling 595..679 CDD:238492 23/84 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.