DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loco and LNX2

DIOPT Version :9

Sequence 1:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_699202.1 Gene:LNX2 / 222484 HGNCID:20421 Length:690 Species:Homo sapiens


Alignment Length:171 Identity:41/171 - (23%)
Similarity:67/171 - (39%) Gaps:47/171 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LPITGASGSTAVGTGAAAA---------------EDASPAANSGPAPIS-----TSTTPS----- 47
            :.:|..|.|.||....|:|               |:|:..|...|:..|     .|.:||     
Human   525 IDLTNLSHSEAVAMLKASAASPAVALKALEVQIVEEATQNAEEQPSTFSENEYDASWSPSWVMWL 589

  Fly    48 GSNSQQHQRRRKKRANYNYNGIRTVEVRRGYNG-FGFTISG-------QQPCRLSCIISSSPAEQ 104
            |..|..|             ....:.:||.|.| :||:|.|       .||..:..|:..:||..
Human   590 GLPSTLH-------------SCHDIVLRRSYLGSWGFSIVGGYEENHTNQPFFIKTIVLGTPAYY 641

  Fly   105 AG-LRSGDFLISVNGLNVSKLPHETVVQLIGNSFGSIRMQI 144
            .| |:.||.:::||||:...:.|..:|.::......:.:.:
Human   642 DGRLKCGDMIVAVNGLSTVGMSHSALVPMLKEQRNKVTLTV 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492 23/85 (27%)
PTB_RGS12 251..391 CDD:269984
RGS_R12-like 828..941 CDD:188661
RGS12_RBD 1073..1145 CDD:176412
RBD 1144..1213 CDD:128731
LNX2NP_699202.1 mRING-HC-C3HC3D_LNX2 45..89 CDD:319694
modified RING-HC finger (C3HC3D-type) 50..87 CDD:319694
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..224
NPXY motif 208..211
PDZ 230..316 CDD:214570
PDZ 336..422 CDD:214570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 418..455
PDZ_signaling 466..542 CDD:238492 5/16 (31%)
PDZ_signaling 599..683 CDD:238492 23/84 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.