DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loco and F16G10.5

DIOPT Version :9

Sequence 1:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_494256.3 Gene:F16G10.5 / 184580 WormBaseID:WBGene00017520 Length:92 Species:Caenorhabditis elegans


Alignment Length:69 Identity:20/69 - (28%)
Similarity:34/69 - (49%) Gaps:7/69 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 SLSLQSSSGG-----VLATYSSARLNFVSSSSESENRF-FGLVTSAVHNTQIEEEYEPSAGSAAA 359
            |:.|:.:|.|     |:.......::|||..|.|.:.| .|.|..||::.|: .:.:....|..|
 Worm     9 SVGLKKASNGEFGLQVMDGIRGPVISFVSPGSASAHIFRAGDVIMAVNDRQV-TDMKTVQDSFEA 72

  Fly   360 AGHI 363
            ||::
 Worm    73 AGNV 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492
PTB_RGS12 251..391 CDD:269984 20/69 (29%)
RGS_R12-like 828..941 CDD:188661
RGS12_RBD 1073..1145 CDD:176412
RBD 1144..1213 CDD:128731
F16G10.5NP_494256.3 PDZ 7..84 CDD:214570 20/69 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.