powered by:
Protein Alignment loco and F16G10.5
DIOPT Version :9
Sequence 1: | NP_732773.1 |
Gene: | loco / 42672 |
FlyBaseID: | FBgn0020278 |
Length: | 1541 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_494256.3 |
Gene: | F16G10.5 / 184580 |
WormBaseID: | WBGene00017520 |
Length: | 92 |
Species: | Caenorhabditis elegans |
Alignment Length: | 69 |
Identity: | 20/69 - (28%) |
Similarity: | 34/69 - (49%) |
Gaps: | 7/69 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 301 SLSLQSSSGG-----VLATYSSARLNFVSSSSESENRF-FGLVTSAVHNTQIEEEYEPSAGSAAA 359
|:.|:.:|.| |:.......::|||..|.|.:.| .|.|..||::.|: .:.:....|..|
Worm 9 SVGLKKASNGEFGLQVMDGIRGPVISFVSPGSASAHIFRAGDVIMAVNDRQV-TDMKTVQDSFEA 72
Fly 360 AGHI 363
||::
Worm 73 AGNV 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.